PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_4684_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 500aa    MW: 54564.2 Da    PI: 8.7704
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_4684_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-1656100147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          r rWT+eE++++++a k++G   W++I +++g  +t+ q++s+ qk+
  cra_locus_4684_iso_4_len_2662_ver_3  56 RERWTEEEHKKFLEALKLYGRA-WRRIEEHVG-SKTAVQIRSHAQKF 100
                                          78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-1650104IPR009057Homeodomain-like
PROSITE profilePS5129421.10751105IPR017930Myb domain
TIGRFAMsTIGR015574.7E-1754103IPR006447Myb domain, plants
SMARTSM007174.0E-1355103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-95696IPR009057Homeodomain-like
PfamPF002492.4E-135699IPR001005SANT/Myb domain
CDDcd001673.48E-1058101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MAIQGQSNNS ESSSTISIGN QISLHVDIPS TKNEQFQCED DCLPKVRKPY TITKQRERWT  60
EEEHKKFLEA LKLYGRAWRR IEEHVGSKTA VQIRSHAQKF FSKVVRESTN GDSGSGKVIE  120
IPPPRPKRKP LHPYPRKLVS PAKSGTATSQ KLTQTVSPNI SSPAEEHQSP TSVLSAPCSD  180
TPGTTDSATS DGSESLSPIS SVVGAKSVGF VLSELPDLTS ETKRSPSSSQ VNSSADNKSP  240
STSQVNNCAN QADQLHLKLE LFPQDNAFDK EGSVEVSSSQ IFKLFGKTVL VIDPSRPSSS  300
TPGAGKVQPS HQNDGKSNST KVPLGESECL RRALPCKARG NLYPSSLQRE CPDTLLCGPF  360
HSLPWLMMYQ GDSSASFVQV HSPIAIKAQP LLDKKELHRV QSCKGGSSTG SDAESESIET  420
VEDKNIEVKF RELSQEGEVQ KQKLPLLKPG AKAASFFRQK ANSSKCGKGF VPYKRCLSDR  480
DTLSAITGEE REEQRVRLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA1DR850.0A1DR85_CATRO; MYB transcription factor (Fragment)